Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CKII alpha prime polypeptide Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CKII alpha prime polypeptide |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156402
|
Novus Biologicals
NBP156402 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CKII alpha prime polypeptide Polyclonal specifically detects CKII alpha prime polypeptide in Human samples. It is validated for Western Blot, Immunoprecipitation.Specifications
| CKII alpha prime polypeptide | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| casein kinase 2, alpha prime polypeptide, casein kinase II subunit alpha', CK II alpha', CK2A2, CSNK2A1, EC 2.7.11, EC 2.7.11.1, FLJ43934 | |
| CSNK2A2 | |
| IgG | |
| Affinity Purified | |
| This product is specific to Subunit or Isoform: alpha'. |
| Polyclonal | |
| Rabbit | |
| Protein Kinase, Wnt Signaling Pathway | |
| P19784 | |
| 1459 | |
| Synthetic peptides corresponding to CSNK2A2(casein kinase 2, alpha prime polypeptide) The peptide sequence was selected from the C terminal of CSNK2A2. Peptide sequence LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title