Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CKII alpha prime polypeptide Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CKII alpha prime polypeptide
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
Regulatory Status RUO
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156402
View Documents
Novus Biologicals
NBP156402
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

CKII alpha prime polypeptide Polyclonal specifically detects CKII alpha prime polypeptide in Human samples. It is validated for Western Blot, Immunoprecipitation.
Specifications

Specifications

CKII alpha prime polypeptide
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
casein kinase 2, alpha prime polypeptide, casein kinase II subunit alpha', CK II alpha', CK2A2, CSNK2A1, EC 2.7.11, EC 2.7.11.1, FLJ43934
CSNK2A2
IgG
Affinity Purified
This product is specific to Subunit or Isoform: alpha'.
Polyclonal
Rabbit
Protein Kinase, Wnt Signaling Pathway
P19784
1459
Synthetic peptides corresponding to CSNK2A2(casein kinase 2, alpha prime polypeptide) The peptide sequence was selected from the C terminal of CSNK2A2. Peptide sequence LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit