Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CKIP-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | CKIP-1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CKIP-1 Polyclonal specifically detects CKIP-1 in Human samples. It is validated for Western Blot.Specifications
| CKIP-1 | |
| Polyclonal | |
| Rabbit | |
| Q53GL0 | |
| 51177 | |
| Synthetic peptides corresponding to PLEKHO1 (pleckstrin homology domain containing, family O member 1) The peptide sequence was selected from the N terminal of PLEKHO1. Peptide sequence MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 2810052M02Rik, Casein kinase 2-interacting protein 1, C-Jun-binding protein, CK2 interacting protein 1; HQ0024c protein, CK2-interacting protein 1, CKIP1, CKIP-1PH domain-containing family O member 1, JBP, OC120, Osteoclast maturation-associated gene 120 protein, pleckstrin homology domain containing, family O member 1, pleckstrin homology domain-containing family O member 1 | |
| PLEKHO1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title