CKIP-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156986

Catalog No. NBP156986

Description

CKIP-1 Polyclonal specifically detects CKIP-1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CKIP-1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q53GL0
• Gene Symbols: PLEKHO1
• Immunogen: Synthetic peptides corresponding to PLEKHO1 (pleckstrin homology domain containing, family O member 1) The peptide sequence was selected from the N terminal of PLEKHO1. Peptide sequence MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 2810052M02Rik, Casein kinase 2-interacting protein 1, C-Jun-binding protein, CK2 interacting protein 1; HQ0024c protein, CK2-interacting protein 1, CKIP1, CKIP-1PH domain-containing family O member 1, JBP, OC120, Osteoclast maturation-associated gene 120 protein, pleckstrin homology domain containing, family O member 1, pleckstrin homology domain-containing family O member 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51177
• Target Species: Human, Rat, Porcine, Bovine
• Isotype: IgG