Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CKIP-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | CKIP-1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156986
|
Novus Biologicals
NBP156986 |
100 μL |
Each of 1 for $436.00
|
|
Description
CKIP-1 Polyclonal specifically detects CKIP-1 in Human samples. It is validated for Western Blot.Specifications
CKIP-1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
2810052M02Rik, Casein kinase 2-interacting protein 1, C-Jun-binding protein, CK2 interacting protein 1; HQ0024c protein, CK2-interacting protein 1, CKIP1, CKIP-1PH domain-containing family O member 1, JBP, OC120, Osteoclast maturation-associated gene 120 protein, pleckstrin homology domain containing, family O member 1, pleckstrin homology domain-containing family O member 1 | |
PLEKHO1 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q53GL0 | |
51177 | |
Synthetic peptides corresponding to PLEKHO1 (pleckstrin homology domain containing, family O member 1) The peptide sequence was selected from the N terminal of PLEKHO1. Peptide sequence MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title