Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Claudin-16 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | Claudin-16 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15910520
|
Novus Biologicals
NBP15910520UL |
20 μL |
Each for $152.22
|
|
NBP159105
|
Novus Biologicals
NBP159105 |
100 μL |
Each for $436.00
|
|
Description
Claudin-16 Polyclonal specifically detects Claudin-16 in Human, Mouse samples. It is validated for Western Blot.Specifications
Claudin-16 | |
Polyclonal | |
Purified | |
RUO | |
Q9Y5I7 | |
10686 | |
Synthetic peptides corresponding to CLDN16 (claudin 16) The peptide sequence was selected from the C terminal of CLDN16. Peptide sequence FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
claudin 16, claudin-16, HOMG3paracellin-1, Paracellin-1, PCLN-1, PCLN1hypomagnesemia 3, with hypercalciuria and nephrocalcinosis | |
CLDN16 | |
IgG | |
Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title