Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Claudin-3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$501.50
Specifications
| Antigen | Claudin-3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Claudin-3 Polyclonal specifically detects Claudin-3 in Mouse samples. It is validated for Western Blot.Specifications
| Claudin-3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers, Extracellular Matrix | |
| PBS buffer, 2% sucrose | |
| 1365 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| C7orf1, claudin 3, claudin-3, Clostridium perfringens enterotoxin receptor 2, CPE-R 2, CPE-R2, CPETR2CPE-receptor 2, HRVP1, Rat ventral prostate.1 protein homolog, RVP1, ventral prostate.1 protein homolog, ventral prostate.1-like protein | |
| The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_034032). Peptide sequence VPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPRDKYAPTKILYSAP | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title