Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Claudin-3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | Claudin-3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB126011
|
Novus Biologicals
NBP310555100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
Claudin-3 Polyclonal specifically detects Claudin-3 in Mouse samples. It is validated for Western Blot.Specifications
| Claudin-3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers, Extracellular Matrix | |
| PBS buffer, 2% sucrose | |
| 1365 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| C7orf1, claudin 3, claudin-3, Clostridium perfringens enterotoxin receptor 2, CPE-R 2, CPE-R2, CPETR2CPE-receptor 2, HRVP1, Rat ventral prostate.1 protein homolog, RVP1, ventral prostate.1 protein homolog, ventral prostate.1-like protein | |
| The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_034032). Peptide sequence VPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPRDKYAPTKILYSAP | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title