Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Claudin-6 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310557100UL
Description
Claudin-6 Polyclonal specifically detects Claudin-6 in Mouse samples. It is validated for Western Blot.Specifications
Claudin-6 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
claudin 6, claudin-6, skullin | |
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_061247). Peptide sequence GASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGP | |
100 μg | |
Stem Cell Markers | |
9074 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction