Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Claudin-6 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen Claudin-6
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126016
View Documents
Novus Biologicals
NBP31055725UL
25 μg
Each for $106.19
Add to cart
 
NB126015
View Documents
Novus Biologicals
NBP310557100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

Claudin-6 Polyclonal antibody specifically detects Claudin-6 in Mouse samples. It is validated for Western Blot
Specifications

Specifications

Claudin-6
Western Blot
Purified
RUO
Mouse
claudin 6, claudin-6, skullin
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_061247). Peptide sequence GASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGP
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Stem Cell Markers
PBS buffer, 2% sucrose
9074
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit