Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLCN1 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen CLCN1
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1692420
View Documents
Novus Biologicals
NBP16912420UL
20 μL
Each for $152.22
Add to cart
 
NBP169124
View Documents
Novus Biologicals
NBP169124
100 μL
Each for $436.00
Add to cart
 
Description

Description

CLCN1 Polyclonal specifically detects CLCN1 in Mouse, Rat samples. It is validated for Western Blot.
Specifications

Specifications

CLCN1
Polyclonal
Rabbit
chloride channel 1, skeletal muscle, Chloride channel protein, skeletal muscle, clC-1, CLC1chloride channel protein 1, MGC138361, MGC142055
CLCN1
IgG
Affinity Purified
110 kDa
Western Blot, Immunohistochemistry
Unconjugated
RUO
1180
Synthetic peptides corresponding to Clcn1 (chloride channel 1) The peptide sequence was selected from the C terminal of Clcn1. Peptide sequence SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit