Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLCN5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16912320UL
Description
CLCN5 Polyclonal specifically detects CLCN5 in Mouse, Rat samples. It is validated for Western Blot.Specifications
CLCN5 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
chloride channel 5, Chloride channel protein 5, Chloride transporter ClC-5, clC-5, CLC5, CLCK2NPHL2, DENTSNPHL1, H(+)/Cl(-) exchange transporter 5, hCIC-K2, hClC-K2, nephrolithiasis 1 (X-linked), nephrolithiasis 2, X-linked, XLRH, XRN | |
Rabbit | |
83 kDa | |
20 μL | |
Primary | |
Human, Mouse, Rat | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
CLCN5 | |
Synthetic peptides corresponding to Clcn5 (chloride channel 5) The peptide sequence was selected from the middle region of Clcn5. Peptide sequence LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL. | |
Affinity Purified | |
RUO | |
1184 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction