Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLEC-2/CLEC-1B Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17920320UL

 View more versions of this product

Catalog No. NBP17920320


Add to cart

Description

Description

CLEC-2/CLEC-1B Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

CLEC-2/CLEC-1B
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CLEC1B
The immunogen for this antibody is Clec1b. Peptide sequence MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL.
Immunogen affinity purified
RUO
Primary
51266
Western Blot
Western Blot 1:1000
NP_064369
1810061I13Rik, CLEC-2, CLEC2B, CLEC2PRO1384, C-type lectin domain family 1 member B, C-type lectin domain family 1, member B, C-type lectin-like receptor 2, C-type lectin-like receptor-2, QDED721
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit