CLEC3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB404903	Novus Biologicals NBP23059525UL	25 μL
NBP230595	Novus Biologicals NBP230595	0.1 mL

Description

CLEC3A Polyclonal specifically detects CLEC3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CLEC3A
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Cartilage-derived C-type lectin, CLECSF1, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 1 (cartilage-derived), C-type lectin domain family 3 member A, C-type lectin domain family 3, member A, C-type lectin superfamily member 1, C-type lectin, superfamily member 1, MGC129558, MGC129559
• Gene Symbols: CLEC3A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Immunofluorescence
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: O75596
• Gene ID (Entrez): 10143
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only