CLEC4E Recombinant Protein, Abnova Available on GSA/VA Contract for Federal Government customers only.

Human CLEC4E full-length ORF recombinant protein with GST-tag at N-terminal

Manufacturer: Abnova Corporation H00026253P0125

 View more versions of this product

Catalog No. 89-012-492

  Check Availability
Add to Cart

    Specifications

    Cross Reactivity Human
    For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blotting (Recombinant Protein)
    Format Solution
    Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
    Molecular Weight 49.83
    Name Human CLEC4E Full-length ORF Recombinant Protein with GST-tag at N-terminal
    pH Range 8
    Preparation Method In vitro wheat germ expression system
    Purification Method Glutathione Sepharose 4 Fast Flow
    Quality Control Testing 12.5% SDS-PAGE stained with Coomassie Blue
    Quantity 25μg
    Recombinant Yes
    Source Wheat Germ (in vitro)
    Storage Requirements -80°C

    This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.

    • Theoretical MW (kDa): 49.83
    • Preparation method: In vitro wheat germ expression system
    • Purification: Glutathione Sepharose 4 fast flow
    • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

    Sequence: MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL

    Best use within three months from the date of receipt of this protein.

    ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit