Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CLIC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180058
Description
CLIC2 Polyclonal specifically detects CLIC2 in Human samples. It is validated for Western Blot.Specifications
CLIC2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
NP_001280 | |
CLIC2 | |
Synthetic peptide directed towards the C terminal of human CLIC2. Peptide sequence SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG. | |
100 μL | |
Signal Transduction | |
1193 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chloride intracellular channel 2, chloride intracellular channel protein 2, XAP121CLIC2b | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Chicken: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title