Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLIC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CLIC2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180058
View Documents
Novus Biologicals
NBP180058
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

CLIC2 Polyclonal specifically detects CLIC2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CLIC2
Polyclonal
Purified
RUO
NP_001280
1193
Synthetic peptide directed towards the C terminal of human CLIC2. Peptide sequence SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
chloride intracellular channel 2, chloride intracellular channel protein 2, XAP121CLIC2b
CLIC2
IgG
Protein A purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit