Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CMG-2/ANTXR2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | CMG-2/ANTXR2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP168911
|
Novus Biologicals
NBP168911 |
100 μL |
Each of 1 for $436.00
|
|
Description
CMG-2/ANTXR2 Polyclonal specifically detects CMG-2/ANTXR2 in Mouse samples. It is validated for Western Blot.Specifications
CMG-2/ANTXR2 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
anthrax toxin receptor 2, Capillary morphogenesis gene 2 protein, capillary morphogenesis protein 2, CMG2MGC111533, CMG-2MGC45856, FLJ31074, ISH, JHF | |
ANTXR2 | |
IgG | |
Affinity Purified | |
53 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q6DFX2 | |
118429 | |
Synthetic peptides corresponding to Antxr2 (anthrax toxin receptor 2) The peptide sequence was selected from the N terminal of Antxr2. Peptide sequence GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title