Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CMG-2/ANTXR2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CMG-2/ANTXR2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP168911
View Documents
Novus Biologicals
NBP168911
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

CMG-2/ANTXR2 Polyclonal specifically detects CMG-2/ANTXR2 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

CMG-2/ANTXR2
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
anthrax toxin receptor 2, Capillary morphogenesis gene 2 protein, capillary morphogenesis protein 2, CMG2MGC111533, CMG-2MGC45856, FLJ31074, ISH, JHF
ANTXR2
IgG
Affinity Purified
53 kDa
Western Blot
Unconjugated
RUO
Q6DFX2
118429
Synthetic peptides corresponding to Antxr2 (anthrax toxin receptor 2) The peptide sequence was selected from the N terminal of Antxr2. Peptide sequence GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit