Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CMG-2/ANTXR2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00


Antigen CMG-2/ANTXR2
Immunogen Synthetic peptides corresponding to Antxr2 (anthrax toxin receptor 2) The peptide sequence was selected from the N terminal of Antxr2. Peptide sequence GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP168920UL View Documents Novus BiologicalsSupplier Diversity Partner
20ul Each for $149.00
Add to cart
NBP168911 View Documents Novus BiologicalsSupplier Diversity Partner
100 ul Each for $329.00
Add to cart


CMG-2/ANTXR2 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.


Affinity Purified
Western Blot
Synthetic peptides corresponding to Antxr2 (anthrax toxin receptor 2) The peptide sequence was selected from the N terminal of Antxr2. Peptide sequence GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG.
anthrax toxin receptor 2, Capillary morphogenesis gene 2 protein, capillary morphogenesis protein 2, CMG2MGC111533, CMG-2MGC45856, FLJ31074, ISH, JHF
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit