Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CML2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | CML2 |
|---|---|
| Immunogen | Synthetic peptides corresponding to NAT8B(N-acetyltransferase 8B (gene/pseudogene)) The peptide sequence was selected from the middle region of NAT8B. Peptide sequence SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP1600220 |
Novus Biologicals
NBP16001220UL |
20ul |
Each for $149.00
|
|
NBP160012 |
Novus Biologicals
NBP160012 |
100 ul |
Each for $329.00
|
|
Description
CML2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| CML2 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 51471 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to NAT8B(N-acetyltransferase 8B (gene/pseudogene)) The peptide sequence was selected from the middle region of NAT8B. Peptide sequence SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA. | |
| Primary | |
| IgG | |
| Camello-like protein 2, CML2, EC 2.3.1, EC 2.3.1.-, Hcml2, MGC97061, N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene), N-acetyltransferase 8B (gene/pseudogene), N-acetyltransferase Camello 2, NAT8BP, probable N-acetyltransferase 8B | |
| PBS & 2% Sucrose. with No Preservative | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title