CNNM4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159423

Catalog No. NBP159423

Description

CNNM4 Polyclonal specifically detects CNNM4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CNNM4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6P4Q7
• Gene Symbols: CNNM4
• Immunogen: Synthetic peptides corresponding to CNNM4(cyclin M4) The peptide sequence was selected from the middle region of CNNM4. Peptide sequence LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA.
• Quantity: 100 μL
• Research Discipline: Vision
• Gene ID (Entrez): 26504
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ACDP4cyclin-M4, Ancient conserved domain-containing protein 4, cyclin M4, Cyclin-M4, FLJ37746, FLJ42791, KIAA1592ancient conserved domain protein 4, metal transporter CNNM4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Bovine: 92%; Equine: 92%; Rat: 92%; Guinea pig: 85%; Zebrafish: 83%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG