Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CNOX Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | CNOX |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157364
|
Novus Biologicals
NBP157364 |
100 μL |
Each for $436.00
|
|
NBP15736420
|
Novus Biologicals
NBP15736420UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
CNOX Polyclonal specifically detects CNOX in Human samples. It is validated for Western Blot.Specifications
CNOX | |
Polyclonal | |
Rabbit | |
Q8TC92 | |
55068 | |
Synthetic peptides corresponding to ENOX1(ecto-NOX disulfide-thiol exchanger 1) The peptide sequence was selected from the middle region of ENOX1. Peptide sequence QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
candidate growth-related and time keeping constitutive hydroquinone (NADH)oxidase, Candidate growth-related and time keeping constitutive hydroquinone [NADH]oxidase, cCNOXConstitutive Ecto-NOX, Cell proliferation-inducing gene 38 protein, cNOX, CNOXbA64J21.1, ecto-NOX disulfide-thiol exchanger 1, FLJ10094, PIG38, proliferation-inducing protein 38 | |
ENOX1 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title