Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. CNTFR Rabbit anti-Human, Polyclonal, Novus Biologicals™

CNTFR Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen CNTFR
Immunogen Synthetic peptides corresponding to CNTFR (ciliary neurotrophic factor receptor) The peptide sequence was selected from the C terminal of CNTFR. Peptide sequence VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16894320 View Documents
View Product Certificates
Novus BiologicalsSupplier Diversity Partner
NBP16894320UL 		20ul Each for $149.00
Add to cart
 
NBP168943 View Documents
View Product Certificates
Novus BiologicalsSupplier Diversity Partner
NBP168943 		100 ul Each for $329.00
Add to cart
 
Description

Description

CNTFR Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

CNTFR
Rabbit
Polyclonal
Unconjugated
1271
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to CNTFR (ciliary neurotrophic factor receptor) The peptide sequence was selected from the C terminal of CNTFR. Peptide sequence VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG.
Primary
IgG
ciliary neurotrophic factor receptor, ciliary neurotrophic factor receptor alpha, ciliary neurotrophic factor receptor subunit alpha, CNTF receptor subunit alpha, CNTFR alpha, CNTFR-alpha, MGC1774
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit