Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CNTFR Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | CNTFR |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16894320
|
Novus Biologicals
NBP16894320UL |
20 μL |
Each for $152.22
|
|
NBP168943
|
Novus Biologicals
NBP168943 |
100 μL |
Each for $436.00
|
|
Description
CNTFR Polyclonal specifically detects CNTFR in Human samples. It is validated for Western Blot.Specifications
CNTFR | |
Polyclonal | |
Rabbit | |
Growth and Development, Neuronal Cell Markers | |
P26992 | |
1271 | |
Synthetic peptides corresponding to CNTFR (ciliary neurotrophic factor receptor) The peptide sequence was selected from the C terminal of CNTFR. Peptide sequence VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. | |
41 kDa |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ciliary neurotrophic factor receptor, ciliary neurotrophic factor receptor alpha, ciliary neurotrophic factor receptor subunit alpha, CNTF receptor subunit alpha, CNTFR alpha, CNTFR-alpha, MGC1774 | |
CNTFR | |
IgG | |
Affinity Purified | |
This product is specific to Subunit or Isoform: alpha. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title