Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CNTFR Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen CNTFR
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16894320
View Documents
Novus Biologicals
NBP16894320UL
20 μL
Each for $152.22
Add to cart
 
NBP168943
View Documents
Novus Biologicals
NBP168943
100 μL
Each for $436.00
Add to cart
 
Description

Description

CNTFR Polyclonal specifically detects CNTFR in Human samples. It is validated for Western Blot.
Specifications

Specifications

CNTFR
Polyclonal
Rabbit
Growth and Development, Neuronal Cell Markers
P26992
1271
Synthetic peptides corresponding to CNTFR (ciliary neurotrophic factor receptor) The peptide sequence was selected from the C terminal of CNTFR. Peptide sequence VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
41 kDa
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
ciliary neurotrophic factor receptor, ciliary neurotrophic factor receptor alpha, ciliary neurotrophic factor receptor subunit alpha, CNTF receptor subunit alpha, CNTFR alpha, CNTFR-alpha, MGC1774
CNTFR
IgG
Affinity Purified
This product is specific to Subunit or Isoform: alpha.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit