CNTNAP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159223

Catalog No. NBP159223

Description

CNTNAP4 Polyclonal specifically detects CNTNAP4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CNTNAP4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9C0A0
• Gene Symbols: CNTNAP4
• Immunogen: Synthetic peptides corresponding to CNTNAP4(contactin associated protein-like 4) The peptide sequence was selected from the N terminal of CNTNAP4. Peptide sequence KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Bovine: 85%; Canine: 85%; Rabbit: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CASPR4KIAA1763cell recognition protein CASPR4, Cell recognition molecule Caspr4, contactin associated protein-like 4, contactin-associated protein-like 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 85445
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.