Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Coactosin-like Protein 1/CotL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | Coactosin-like Protein 1/CotL1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1548520
|
Novus Biologicals
NBP15485120UL |
20 μL |
Each for $204.00
|
|
|||||
NBP154851
|
Novus Biologicals
NBP154851 |
100 μL |
Each for $482.50
|
|
|||||
Description
Coactosin-like Protein 1/CotL1 Polyclonal specifically detects Coactosin-like Protein 1/CotL1 in Human samples. It is validated for Western Blot.Specifications
Coactosin-like Protein 1/CotL1 | |
Polyclonal | |
Rabbit | |
Q14019 | |
23406 | |
Synthetic peptides corresponding to COTL1(coactosin-like 1 (Dictyostelium)) The peptide sequence was selected from the N terminal of COTL1. Peptide sequence MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CLPFLJ43657, coactosin-like 1 (Dictyostelium), coactosin-like protein, MGC19733 | |
COTL1 | |
IgG | |
16 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title