Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COBLL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | COBLL1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170505
|
Novus Biologicals
NBP170505 |
100 μL |
Each of 1 for $436.00
|
|
Description
COBLL1 Polyclonal specifically detects COBLL1 in Human samples. It is validated for Western Blot.Specifications
COBLL1 | |
Polyclonal | |
Rabbit | |
Q53SF7 | |
22837 | |
Synthetic peptides corresponding to COBLL1(COBL-like 1) The peptide sequence was selected from the middle region of COBLL1. Peptide sequence QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLP. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
COBL-like 1, COBLR1, cordon-bleu protein-like 1 | |
COBLL1 | |
IgG | |
Affinity Purified | |
128 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title