Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cochlin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Specifications
Antigen | Cochlin |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB6914120UL
|
Novus Biologicals
NBP16914120UL |
20 μL |
Each for $152.22
|
N/A |
NBP169141
|
Novus Biologicals
NBP169141 |
100 μL |
Each for $436.00
|
N/A |
Description
Cochlin Polyclonal specifically detects Cochlin in Human samples. It is validated for Western Blot.Specifications
Cochlin | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
coagulation factor C (Limulus polyphemus homolog); cochlin, coagulation factor C homolog, cochlin (Limulus polyphemus), COCH-5B2COCH5B2, cochlin, DFNA9 | |
COCH | |
IgG | |
Affinity Purified | |
57 kDa |
Western Blot | |
Unconjugated | |
RUO | |
O43405 | |
1690 | |
Synthetic peptides corresponding to COCH (coagulation factor C homolog, cochlin (Limulus polyphemus)) The peptide sequence was selected from the C terminal of COCH. Peptide sequence VAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRGICRDFLESQQ. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title