Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cochlin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$204.00 - $482.50
Specifications
| Antigen | Cochlin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB6914120UL
|
Novus Biologicals
NBP16914120UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP169141
|
Novus Biologicals
NBP169141 |
100 μL |
Each for $482.50
|
|
|||||
Description
Cochlin Polyclonal specifically detects Cochlin in Human samples. It is validated for Western Blot.Specifications
| Cochlin | |
| Polyclonal | |
| Rabbit | |
| O43405 | |
| 1690 | |
| Synthetic peptides corresponding to COCH (coagulation factor C homolog, cochlin (Limulus polyphemus)) The peptide sequence was selected from the C terminal of COCH. Peptide sequence VAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRGICRDFLESQQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| coagulation factor C (Limulus polyphemus homolog); cochlin, coagulation factor C homolog, cochlin (Limulus polyphemus), COCH-5B2COCH5B2, cochlin, DFNA9 | |
| COCH | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title