Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

COG2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15314920UL

 View more versions of this product

Catalog No. NBP15314920

Add to cart



COG2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to COG2(component of oligomeric golgi complex 2) The peptide sequence was selected from the N terminal of COG2. Peptide sequence KRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQ.
83 kDa
Golgi Apparatus Markers
Western Blot
Western Blot 1:100-1:2000
component of oligomeric golgi complex 2COG complex subunit 2, conserved oligomeric Golgi complex protein 2, conserved oligomeric Golgi complex subunit 2, LDLCbrefeldin A-sensitive, peripheral Golgi protein, low density lipoprotein receptor defect C complementing, Low density lipoprotein receptor defect C-complementing protein
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
This product is specific to Subunit or Isoform: 2.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit