COG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15314920UL

Catalog No. NBP15314920

Description

COG2 Polyclonal specifically detects COG2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: COG2
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q14746
• Gene Symbols: COG2
• Immunogen: Synthetic peptides corresponding to COG2(component of oligomeric golgi complex 2) The peptide sequence was selected from the N terminal of COG2. Peptide sequence KRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQ.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 2.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: component of oligomeric golgi complex 2COG complex subunit 2, conserved oligomeric Golgi complex protein 2, conserved oligomeric Golgi complex subunit 2, LDLCbrefeldin A-sensitive, peripheral Golgi protein, low density lipoprotein receptor defect C complementing, Low density lipoprotein receptor defect C-complementing protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 83 kDa
• Quantity: 20 μL
• Research Discipline: Golgi Apparatus Markers
• Gene ID (Entrez): 22796
• Target Species: Human
• Isotype: IgG