Complement Component C2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158984

Catalog No. NBP158984

Description

Complement Component C2 Polyclonal specifically detects Complement Component C2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Complement Component C2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C3/C5 convertase, CO2, complement C2, complement component 2, complement component C2, DKFZp779M0311, EC 3.4.21, EC 3.4.21.43
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 717
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Symbols: C2
• Immunogen: Synthetic peptides corresponding to C2(complement component 2) The peptide sequence was selected from the N terminal of C2. Peptide sequence EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Canine: 92%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG