Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Connexin 30/GJB6 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310836100UL
Description
Connexin 30/GJB6 Polyclonal specifically detects Connexin 30/GJB6 in Mouse samples. It is validated for Western Blot.Specifications
| Connexin 30/GJB6 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| connexin 30, connexin-30, Cx30, CX30gap junction protein, beta 6, DFNA3B, DFNB1B, ectodermal dysplasia 2, hidrotic (Clouston syndrome), ED2, EDH, gap junction beta-6 protein, gap junction protein, beta 6 (connexin 30), gap junction protein, beta 6, 30kDa, HEDDFNA3 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of mouse Connexin 30/GJB6 (NP_001010937.1). Peptide sequence ISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESKQNEMN | |
| 100 μg | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10804 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction