Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COUP-TF I/NR2F1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP152831
Description
COUP-TF I/NR2F1 Polyclonal specifically detects COUP-TF I/NR2F1 in Human samples. It is validated for Western Blot.Specifications
COUP-TF I/NR2F1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
COUP transcription factor 1, COUP-TF1, COUP-TFI, EAR-3COUP transcription factor I, EAR3COUP-TF I, ERBAL3V-erbA-related protein 3, Nuclear receptor subfamily 2 group F member 1, nuclear receptor subfamily 2, group F, member 1, SVP44, TCFCOUP1, TFCOUP1NR2F2, transcription factor COUP 1 (chicken ovalbumin upstream promoter 1, v-erb-ahomolog-like 3) | |
Rabbit | |
Affinity purified | |
RUO | |
7025 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P10589 | |
NR2F1 | |
Synthetic peptides corresponding to NR2F1(nuclear receptor subfamily 2, group F, member 1) The peptide sequence was selected from the C terminal of NR2F1. Peptide sequence VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%. | |
Human, Mouse, Rat, Bovine, Canine, Chicken, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction