COUP-TF I/NR2F1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152831

Catalog No. NBP152831

Description

COUP-TF I/NR2F1 Polyclonal specifically detects COUP-TF I/NR2F1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: COUP-TF I/NR2F1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: COUP transcription factor 1, COUP-TF1, COUP-TFI, EAR-3COUP transcription factor I, EAR3COUP-TF I, ERBAL3V-erbA-related protein 3, Nuclear receptor subfamily 2 group F member 1, nuclear receptor subfamily 2, group F, member 1, SVP44, TCFCOUP1, TFCOUP1NR2F2, transcription factor COUP 1 (chicken ovalbumin upstream promoter 1, v-erb-ahomolog-like 3)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7025
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P10589
• Gene Symbols: NR2F1
• Immunogen: Synthetic peptides corresponding to NR2F1(nuclear receptor subfamily 2, group F, member 1) The peptide sequence was selected from the C terminal of NR2F1. Peptide sequence VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Chicken, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG