Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COUP-TF II/NR2F2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | COUP-TF II/NR2F2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB126653
|
Novus Biologicals
NBP310876100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
COUP-TF II/NR2F2 Polyclonal specifically detects COUP-TF II/NR2F2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| COUP-TF II/NR2F2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Apolipoprotein A-I regulatory protein 1, ARP-1, ARP1ADP-ribosylation factor related protein 1, chicken ovalbumin upstream promoter transcription factor 2, COUP transcription factor 2, COUP transcription factor II, COUP-TF II, COUP-TF2, COUPTFB, COUPTFII, COUP-TFII, MGC117452, Nuclear receptor subfamily 2 group F member 2, nuclear receptor subfamily 2, group F, member 2, SVP40, TFCOUP2apolipoprotein AI regulatory protein 1 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human COUP-TF II/NR2F2 (NP_066285). Peptide sequence KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 7026 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title