Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CP2F2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | CP2F2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19826920
|
Novus Biologicals
NBP19826920UL |
20 μL |
Each for $204.00
|
|
|||||
NBP198269
|
Novus Biologicals
NBP198269 |
100 μL |
Each for $482.50
|
|
|||||
Description
CP2F2 Polyclonal specifically detects CP2F2 in Rat samples. It is validated for Western Blot.Specifications
CP2F2 | |
Polyclonal | |
Rabbit | |
NP_062176 | |
The immunogen for this antibody is CP2F2 - middle region. Peptide sequence EHQDSLDPNSPRDFIDCFLTKMVQEKQDPLSHFNMDTLLMTTHNLLFGGT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Cyp2f2 | |
IgG | |
54 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title