Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cphx Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19161620UL

 View more versions of this product

Catalog No. NBP19161620


Add to cart

Description

Description

Cphx Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

Cphx
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
C330003B14RIK
Synthetic peptide directed towards the N terminal of mouse C330003B14RIK. Peptide sequence MLSKNFPGAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAP. Accession: NP_780551
22 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Western Blot
Western Blot 1:1000
Q8BX39
AU019881, AU023336, C330003B14Rik, C80129, cytoplasmic polyadenylated homeobox, Eso-1
Rabbit
IgG
Protein A purified
RUO
Primary
105594
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit