Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cphx Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | Cphx |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP191616
|
Novus Biologicals
NBP191616 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
Cphx Polyclonal specifically detects Cphx in Mouse samples. It is validated for Western Blot.Specifications
| Cphx | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q8BX39 | |
| 105594 | |
| Synthetic peptide directed towards the N terminal of mouse C330003B14RIK. Peptide sequence MLSKNFPGAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAP. Accession: NP_780551 | |
| Primary | |
| 22 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| AU019881, AU023336, C330003B14Rik, C80129, cytoplasmic polyadenylated homeobox, Eso-1 | |
| C330003B14RIK | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title