Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPNE4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CPNE4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154323
|
Novus Biologicals
NBP154323 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CPNE4 Polyclonal specifically detects CPNE4 in Human samples. It is validated for Western Blot.Specifications
| CPNE4 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| copine 8, copine IVCOPN4, copine-4, copine-8, CPN4, MGC15604 | |
| CPNE4 | |
| IgG | |
| Affinity Purified | |
| 62 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96A23 | |
| 131034 | |
| Synthetic peptides corresponding to CPNE4(copine IV) The peptide sequence was selected from the C terminal of CPNE4. Peptide sequence EAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title