Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPNE5 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17967720UL

 View more versions of this product

Catalog No. NBP17967720


Add to cart

Description

Description

CPNE5 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

CPNE5
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CPNE5
Synthetic peptide directed towards the N terminal of human Cpne5The immunogen for this antibody is Cpne5. Peptide sequence SLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQ.
65 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Western Blot
Western Blot 1:1000
NP_694806
copine VKIAA1599CPN5COPN5, copine-5, DKFZp666C234
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
57699
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit