Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPSF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen CPSF1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15743420
View Documents
Novus Biologicals
NBP15743420UL
20 μL
Each for $152.22
Add to cart
 
NBP157434
View Documents
Novus Biologicals
NBP157434
100 μL
Each for $436.00
Add to cart
 
Description

Description

CPSF1 Polyclonal specifically detects CPSF1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CPSF1
Polyclonal
Rabbit
Q10570
29894
Synthetic peptides corresponding to CPSF1(cleavage and polyadenylation specific factor 1, 160kDa) The peptide sequence was selected from the middle region of CPSF1. Peptide sequence GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
cleavage and polyadenylation specific factor 1, 160kD subunit, cleavage and polyadenylation specific factor 1, 160kDa, Cleavage and polyadenylation specificity factor 160 kDa subunit, cleavage and polyadenylation specificity factor subunit 1, CPSF 160 kDa subunit, CPSF160, HSU37012, P/cl.18, polyadenylation specificity factor
CPSF1
IgG
Affinity Purified
This product is specific to Subunit or Isoform: 1.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit