Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPSF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | CPSF1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15743420
|
Novus Biologicals
NBP15743420UL |
20 μL |
Each for $152.22
|
|
NBP157434
|
Novus Biologicals
NBP157434 |
100 μL |
Each for $436.00
|
|
Description
CPSF1 Polyclonal specifically detects CPSF1 in Human samples. It is validated for Western Blot.Specifications
CPSF1 | |
Polyclonal | |
Rabbit | |
Q10570 | |
29894 | |
Synthetic peptides corresponding to CPSF1(cleavage and polyadenylation specific factor 1, 160kDa) The peptide sequence was selected from the middle region of CPSF1. Peptide sequence GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
cleavage and polyadenylation specific factor 1, 160kD subunit, cleavage and polyadenylation specific factor 1, 160kDa, Cleavage and polyadenylation specificity factor 160 kDa subunit, cleavage and polyadenylation specificity factor subunit 1, CPSF 160 kDa subunit, CPSF160, HSU37012, P/cl.18, polyadenylation specificity factor | |
CPSF1 | |
IgG | |
Affinity Purified | |
This product is specific to Subunit or Isoform: 1. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title