Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPSF6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157541

 View more versions of this product

Catalog No. NBP157541


Add to cart

Description

Description

CPSF6 Polyclonal specifically detects CPSF6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

CPSF6
Polyclonal
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:10-1:500
CFIM, CFIm68, CFIM68CPSF 68 kDa subunit, CFIMcleavage and polyadenylation specific factor 6, 68kD subunit, cleavage and polyadenylation specific factor 6, 68kDa, Cleavage and polyadenylation specificity factor 68 kDa subunit, cleavage and polyadenylation specificity factor subunit 6, HPBRII-4, HPBRII-7, pre-mRNA cleavage factor I, 68kD subunit, pre-mRNA cleavage factor Im (68kD), Pre-mRNA cleavage factor Im 68 kDa subunit, Protein HPBRII-4/7
Rabbit
Protein A purified
RUO
11052
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at -20C. Avoid freeze-thaw cycles.
IgG
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
CPSF6
Synthetic peptides corresponding to CPSF6 (cleavage and polyadenylation specific factor 6, 68kDa) The peptide sequence was selected from the middle region of CPSF6. Peptide sequence PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP.
100 μL
Primary
This product is specific to Subunit or Isoform: 6.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Purified
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit