Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPT1B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317029100UL
Description
CPT1B Polyclonal antibody specifically detects CPT1B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
CPT1B | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
carnitine O-palmitoyltransferase 1, muscle isoform, carnitine O-palmitoyltransferase I, mitochondrial muscle isoform, Carnitine O-palmitoyltransferase I, muscle isoform, Carnitine palmitoyltransferase 1B, carnitine palmitoyltransferase 1B (muscle), Carnitine palmitoyltransferase I-like protein, CPT I, CPT1M, CPT1-MMCCPT1, CPTI, CPTI-M, EC 2.3.1, EC 2.3.1.21, FLJ55729, FLJ58750, KIAA1670, MCPT1, M-CPT1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: VPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSW | |
100 μg | |
Lipid and Metabolism | |
1375 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction