Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CRN Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen CRN
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126313
View Documents
Novus Biologicals
NBP310706100UL
100 μg N/A
NB126314
View Documents
Novus Biologicals
NBP31070625UL
25 μg N/A
Description

Description

CRN Polyclonal antibody specifically detects CRN in Human samples. It is validated for Western Blot
Specifications

Specifications

CRN
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
51340
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
CLF, Clf1, Crn, Crooked Neck-Like 1, Crn, Crooked Neck-Like 1 (Drosophila), CRNKL1, Crooked Neck (Drosophila Crn Homolog)-Like 1, Crooked Neck Homolog, Crooked Neck Pre-MRNA Splicing Factor 1, Crooked Neck Pre-MRNA Splicing Factor-Like 1 (Drosophila), Crooked Neck-Like 1, Crooked Neck-Like Protein 1, hCrn, MSTP021, SYF3, SYF3 Pre-MRNA-Splicing Factor
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CRN (NP_057736). Peptide sequence SFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPED
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit