Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CRTAC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CRTAC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157722
View Documents
Novus Biologicals
NBP157722
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

CRTAC1 Polyclonal specifically detects CRTAC1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CRTAC1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
ASPIC, ASPIC1CEP-68acidic secreted protein in cartilage, cartilage acidic protein 1, CEP68, chondrocyte expressed protein 68 kDa CEP-68,68 kDa chondrocyte-expressed protein, FLJ10320
CRTAC1
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q9NQ79
55118
Synthetic peptides corresponding to CRTAC1 (cartilage acidic protein 1) The peptide sequence was selected from the N terminal of CRTAC1)(50ug). Peptide sequence FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit