Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CRTAC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | CRTAC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157722
|
Novus Biologicals
NBP157722 |
100 μL |
Each of 1 for $436.00
|
|
Description
CRTAC1 Polyclonal specifically detects CRTAC1 in Human samples. It is validated for Western Blot.Specifications
CRTAC1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ASPIC, ASPIC1CEP-68acidic secreted protein in cartilage, cartilage acidic protein 1, CEP68, chondrocyte expressed protein 68 kDa CEP-68,68 kDa chondrocyte-expressed protein, FLJ10320 | |
CRTAC1 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q9NQ79 | |
55118 | |
Synthetic peptides corresponding to CRTAC1 (cartilage acidic protein 1) The peptide sequence was selected from the N terminal of CRTAC1)(50ug). Peptide sequence FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title