Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CRYBA2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | CRYBA2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB126455
|
Novus Biologicals
NBP310777100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
CRYBA2 Polyclonal specifically detects CRYBA2 in Human samples. It is validated for Western Blot.Specifications
| CRYBA2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Vision | |
| PBS buffer, 2% sucrose | |
| 1412 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Beta-A2 crystallin, beta-crystallin A2, crystallin, beta A2, eye lens structural protein | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human CRYBA2 (NP_476435). Peptide sequence GVWVAFEYPDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCAN | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title