CRYBB3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155088

Catalog No. NBP155088

Description

CRYBB3 Polyclonal specifically detects CRYBB3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CRYBB3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P26998
• Gene Symbols: CRYBB3
• Immunogen: Synthetic peptides corresponding to CRYBB3(crystallin, beta B3) The peptide sequence was selected from the middle region of CRYBB3. Peptide sequence LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Beta-B3 crystallin, beta-crystallin B3, CATCN2, CRYB3MGC125774, crystallin, beta B3, eye lens structural protein, MGC125772, MGC125773
• Host Species: Rabbit
• Molecular Weight of Antigen: 24 kDa
• Quantity: 100 μL
• Research Discipline: Vision
• Gene ID (Entrez): 1417
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG