Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CRYBB3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CRYBB3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155088
|
Novus Biologicals
NBP155088 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CRYBB3 Polyclonal specifically detects CRYBB3 in Human samples. It is validated for Western Blot.Specifications
| CRYBB3 | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| P26998 | |
| 1417 | |
| Synthetic peptides corresponding to CRYBB3(crystallin, beta B3) The peptide sequence was selected from the middle region of CRYBB3. Peptide sequence LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Beta-B3 crystallin, beta-crystallin B3, CATCN2, CRYB3MGC125774, crystallin, beta B3, eye lens structural protein, MGC125772, MGC125773 | |
| CRYBB3 | |
| IgG | |
| Affinity Purified | |
| 24 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title