Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CSN7b Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | CSN7b |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB126559
|
Novus Biologicals
NBP310829100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
CSN7b Polyclonal specifically detects CSN7b in Human samples. It is validated for Western Blot.Specifications
CSN7b | |
Western Blot | |
Unconjugated | |
Rabbit | |
Growth and Development, Neuronal Cell Markers, Neurotransmission, Signal Transduction, Transcription Factors and Regulators | |
PBS buffer, 2% sucrose | |
64708 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
Arabidopsis, homolog) subunit 7B, COP9 constitutive photomorphogenic homolog subunit 7B (Arabidopsis), COP9 signalosome complex subunit 7b, CSN7BMGC111077, FLJ12612, Signalosome subunit 7b | |
The immunogen is a synthetic peptide directed towards the middle region of human CSN7b (NP_001269879.1). Peptide sequence GIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLA | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title