Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CSRP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CSRP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180293
|
Novus Biologicals
NBP180293 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CSRP2 Polyclonal specifically detects CSRP2 in Human samples. It is validated for Western Blot.Specifications
| CSRP2 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, Stem Cell Markers | |
| CRP2LIM domain only protein 5, cysteine and glycine-rich protein 2, Cysteine-rich protein 2, LMO5LMO-5, SMLIM, SmLIMLIM domain only 5, smooth muscle, Smooth muscle cell LIM protein | |
| CSRP2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001312 | |
| 1466 | |
| Synthetic peptide directed towards the C terminal of human CSRP2. Peptide sequence FRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title