Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CTR1 Polyclonal Antibody
CTR1 Polyclonal Antibody
Supplier: Thermo Scientific PA580029
Description
CTR1 Polyclonal Antibody for Western Blot

Specifications
CTR1 | |
Polyclonal | |
Unconjugated | |
SLC31A1 | |
4930445G01Rik; AI787263; AU016967; copper transport 1 homolog; copper transporter 1; Copper uptake transporter 1; COPT1; ctr1; ctr-1; hCTR1; high affinity copper uptake protein; high affinity copper uptake protein 1; high-affinity copper uptake protein; liver regeneration-related protein LRRGT00200; LRRGT00200; rCTR1; SLC31A1; slc31a1.L; solute carrier family 13 (sodium/sulphate symporters), member 1; solute carrier family 31 (copper transporter), member 1; solute carrier family 31 (copper transporter), member 1 L homeolog; solute carrier family 31 (copper transporters), member 1; solute carrier family 31 member 1; solute carrier family 31, member 1; Xctr1; XELAEV_18038194mg; zgc:76839 | |
Rabbit | |
Antigen affinity chromatography | |
RUO | |
1317, 171135, 20529 | |
-20°C | |
Lyophilized |
Western Blot | |
500 μg/mL | |
PBS with 4mg trehalose and 0.05mg sodium azide | |
O15431, Q8K211, Q9JK41 | |
SLC31A1 | |
A synthetic peptide corresponding to a sequence of human SLC31A1/CTR1 (NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction