Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CXorf66 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | CXorf66 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170520UL
|
Novus Biologicals
NBP17051120UL |
20 μL |
Each for $152.22
|
|
NBP170511
|
Novus Biologicals
NBP170511 |
100 μL |
Each for $436.00
|
|
Description
CXorf66 Polyclonal specifically detects CXorf66 in Human samples. It is validated for Western Blot.Specifications
CXorf66 | |
Polyclonal | |
Rabbit | |
Human | |
chromosome X open reading frame 66, hypothetical protein LOC347487 | |
CXORF66 | |
IgG | |
Affinity Purified | |
40 kDa |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
347487 | |
Synthetic peptides corresponding to CXorf66(chromosome X open reading frame 66) The peptide sequence was selected from the middle region of CXorf66. Peptide sequence PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title