Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cyclin T1 Monoclonal Antibody (3B7), Invitrogen™

Mouse Monoclonal Antibody

Supplier:  Thermo Scientific MA549233

Encompass

Catalog No. PIMA549233


Add to Cart

Description

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is different from the related mouse sequence by one amino acid.

Cyclin T1 Monoclonal antibody specifically detects Cyclin T1 in Human samples. It is validated for Flow Cytometry, Western Blot
TRUSTED_SUSTAINABILITY
Specifications

Specifications

Cyclin T1
Monoclonal
500 μg/mL
PBS with 4MG trehalose and no preservative
P50897
Mouse
Antigen affinity chromatography
RUO
5538
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
IgG2b
Flow Cytometry, Western Blot
3B7
Unconjugated
Ppt1
2810478G24Rik; AI115585; CCNT; CCNT1; CDK9-associated C-type protein; cyclin C-related protein; cyclin T1; cyclin T1b; cyclin-T; cyclin-T1; CycT1; HIVE1; human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1
A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK).
100 μg
Primary
Human
Lyophilized
Recommendations

Recommendations

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit