CYP11B1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168882

Catalog No. NBP168882

Description

CYP11B1 Polyclonal specifically detects CYP11B1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CYP11B1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P15538
• Gene Symbols: CYP11B1
• Immunogen: Synthetic peptides corresponding to CYP11B1 (cytochrome P450, family 11, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP11B1. Peptide sequence LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Rat: 79%; Equine: 79%.
• Target Species: Human, Rat, Equine
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CPN1, CYPXIB1, cytochrome P450 11B1, mitochondrial, cytochrome p450 XIB1, cytochrome P450, family 11, subfamily B, polypeptide 1, cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1, Cytochrome P-450c11, Cytochrome P450C11, EC 1.14.15, EC 1.14.15.4, FHICYP11B, FLJ36771, P450C11DKFZp686B05283, S11BH, Steroid 11-beta-hydroxylase, steroid 11-beta-monooxygenase
• Host Species: Rabbit
• Molecular Weight of Antigen: 55 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 1584
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.